Web stats for Laviedgeinfradevelopers - laviedgeinfradevelopers.com
4.67 Rating by ClearWebStats
laviedgeinfradevelopers.com is 1 year 8 months 6 days old. This website has a #1,382,019 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, laviedgeinfradevelopers.com is SAFE to browse.
Traffic Report of Laviedgeinfradevelopers
Daily Unique Visitors: | 348 |
Daily Pageviews: | 696 |
Estimated Valuation
Income Per Day: | $ 2.00 |
Estimated Worth: | $ 480.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 1,382,019 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is laviedgeinfradevelopers.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 8 |
H3 Headings: | 8 | H4 Headings: | 10 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 5 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 162.241.148.33)
Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute
- shrivishwakarmasafetytraininginstitute.com
The Shine English Academy – DREAM | LEARN | SPEAK
- theshineenglishacademy.com
Urvashi International Packers and Movers|Movers and Packers Hyderabad
- urvashiinternationalpackers.com
Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers
247 Best Pill Pharma – Order Prescription Drugs in our Online shop
- 247bestpillpharma.com
HTTP Header Analysis
HTTP/2 200
link: <https://laviedgeinfradevelopers.com/wp-json/>; rel="https://api.w.org/", <https://laviedgeinfradevelopers.com/wp-json/wp/v2/pages/52>; rel="alternate"; type="application/json", <https://laviedgeinfradevelopers.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
content-type: text/html; charset=UTF-8
date: Fri, 16 Sep 2022 09:59:32 GMT
server: Apache
link: <https://laviedgeinfradevelopers.com/wp-json/>; rel="https://api.w.org/", <https://laviedgeinfradevelopers.com/wp-json/wp/v2/pages/52>; rel="alternate"; type="application/json", <https://laviedgeinfradevelopers.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
content-type: text/html; charset=UTF-8
date: Fri, 16 Sep 2022 09:59:32 GMT
server: Apache
Domain Information for laviedgeinfradevelopers.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
laviedgeinfradevelopers.com | A | 14400 |
IP:162.241.148.33 |
laviedgeinfradevelopers.com | NS | 86400 |
Target:ns2.bh-ht-17.webhostbox.net |
laviedgeinfradevelopers.com | NS | 86400 |
Target:ns1.bh-ht-17.webhostbox.net |
laviedgeinfradevelopers.com | SOA | 86400 |
MNAME:ns1.bh-ht-17.webhostbox.net RNAME:haribabuhosting.gmail.com Serial:2022083001 Refresh:86400 Retry:7200 Expire:3600000 |
laviedgeinfradevelopers.com | MX | 14400 |
Target:mail.laviedgeinfradevelopers.com |
laviedgeinfradevelopers.com | TXT | 14400 |
TXT:v=spf1 a mx include:websitewelcome.com ~all |
Similarly Ranked Websites to Laviedgeinfradevelopers
Welcome to KFDC Ecotourism | Kerala Forest Developement Corporation LTD Offical Website
- kfdcecotourism.com
Full WHOIS Lookup for laviedgeinfradevelopers.com
Domain Name: LAVIEDGEINFRADEVELOPERS.COM
Registry Domain ID: 2720448558_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2022-08-29T05:11:30Z
Creation Date: 2022-08-24T13:51:53Z
Registry Expiry Date: 2023-08-24T13:51:53Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS1.BH-HT-2.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2022-09-16T09:59:30Z
Registry Domain ID: 2720448558_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2022-08-29T05:11:30Z
Creation Date: 2022-08-24T13:51:53Z
Registry Expiry Date: 2023-08-24T13:51:53Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS1.BH-HT-2.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2022-09-16T09:59:30Z